Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody(CSB-RA020067A1HU), the EC50 is 0.2450-0.3416 ng/mL.
Research Area
Neuroscience
Alternative Names
(Neurotrophic tyrosine kinase, receptor-related 1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
30-403aa
Target Protein Sequence
QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human ROR1 is a partial protein derived from mammalian cells, specifically containing the 30-403aa expression region of the Inactive tyrosine-protein kinase transmembrane receptor ROR1. This high-purity protein (greater than 95% as determined by SDS-PAGE) is C-terminal 10xHis-tagged and has an endotoxin level of less than 1.0 EU/µg, as established by the LAL method. ROR1 is primarily utilized in neuroscience research, with its binding ability measured in a functional ELISA. When immobilized at 2 μg/mL, it can bind anti-ROR1 antibody(CSB-RA020067A1HU) with an EC50 of 0.2450-0.3416 ng/mL. The lyophilized powder format ensures easy handling and storage for a variety of research applications.